Bacterial taxon 909946
Locus STM474_4184
Protein WP_072077162.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 66 aa, Gene glnL, UniProt E8XJI8
>WP_072077162.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MRSDCWWRKKPILGWAESFHGNSKTPDAFHAAAALAAFAYPSHIAIYAPGDVLSCCLAATRNLSDF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,236,917 | 2.08 | 0.0053 | ○○○○○ 1.26 | 1.2577222536624 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,236,925 | 0.86 | 0.79 | ○○○○○ 0.62 | 0.623508296719656 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,236,925 | 0.89 | 0.75 | ○○○○○ 0.64 | 0.641093529708925 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,236,917 | 1.21 | 0.4 | ○○○○○ 0.8 | 0.804395677297596 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,236,917 | 1.4 | 0.5 | ○○○○○ 0.9 | 0.901789550480673 | 23637626 |
Retrieved 5 of 5 entries in 1.5 ms
(Link to these results)