Bacterial taxon 909946
Locus STM474_4185
Protein WP_014343926.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 142 aa, Gene n/a, UniProt E8XJI9
>WP_014343926.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MMAMLRKFSITTLPQALEIARYCTRINRTTKQDHKHPPQTSIAESLCDRFHGALKGWLAFCCTNVVLNVHIKALFWCNIVTVVQPFCTMVRMITPFGGNVKVGTDFALYFYGDTASRIEDLVTTTTDHDQSGRVQVCPLNTF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,238,786 | 0.65 | 0.97 | ○○○○○ 0.52 | 0.515025950669269 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,238,786 | 1.52 | 0.78 | ○○○○○ 0.96 | 0.964462310328221 | 23637626 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)