Bacterial taxon 909946
Locus STM474_4191
Protein WP_014343927.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 341 aa, Gene n/a, UniProt E8XJJ5
>WP_014343927.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MCTFPYSTIKGFIVITLIGPHQSKRTHYFMQAAAVLGEPVTALTHPQALDASLTSGIVKIDPPVHSETDIRKINAIGLDYIHFLQNMAARPGVTWLNHPAGLIHLLDKKRCKRRLLEHGIPTPPLVAEDVKSFAQLTAIMEEKRVASVFIKPSLGSGAAGVIALRRHPDGIKQVLYSAIVISGQQLFNSKKIQQYRQKEDIQLIINGVLQQENLVEQWLPKASVKHKTYDLRIVCLDGEIIWRVVRTSSQPITNLHLQNQAYCFESLELSAAKVTEIDTLCQNAMRLFPGIRLAGIDVLLTTSLTPYIIEINGQGDLIYQDAQQNNLIYQAQIRAMRKQNV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,244,616 | -1.46 | 0.028 | ●○○○○ -0.58 | -0.583236875269891 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,244,616 | -0.9 | 0.67 | ●○○○○ -0.29 | -0.292565806187704 | 23637626 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)