Bacterial taxon 909946
Locus STM474_4309
Protein WP_014344250.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 62 aa, Gene sthA, UniProt E8XL81
>WP_014344250.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSESFHMPYSALYQRIKVTGSHWIVNDCLQTVCAPASQKSTTIIGLKLGKCYHRVYFMYKNR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,366,991 | -0.1 | 0.83 | ○○○○○ 0.12 | 0.124233327558489 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,366,991 | 0.66 | 0.94 | ○○○○○ 0.52 | 0.521952989523799 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,366,991 | 0.77 | 0.64 | ○○○○○ 0.57 | 0.574459749266957 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)