Bacterial taxon 909946
Locus STM474_4389
Protein WP_000084331.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 151 aa, Gene n/a, UniProt E8X8V7
>WP_000084331.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MSQTTVWLACYKGRSEHRGIARFADWLTRKVTRGIYSHCELAVAHGGNEYLCYSASFRDRGVRGKIIPLPDDKWDKLPLKATLPEVEVFFRKHNGKRYDWQGALGIALYNRERKDRLFCSEFCAEFLGLNDSWRYSPSHLYALVSSWQYDC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,440,712 | -5.01 | 4.2e-34 | ●●●○○ -2.43 | -2.42505713083626 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,440,902 | -4.26 | 3.0e-21 | ●●●○○ -2.04 | -2.03585889532268 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,440,802 | -2.79 | 3.3e-9 | ●●○○○ -1.27 | -1.27414004678991 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,440,712 | -2.72 | 0.013 | ●●○○○ -1.24 | -1.23769443051485 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,440,800 | -2.13 | 0.022 | ●○○○○ -0.93 | -0.930493453856542 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,440,902 | -2.13 | 0.023 | ●○○○○ -0.93 | -0.929961153669495 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,440,802 | -1.5 | 0.13 | ●○○○○ -0.6 | -0.604392365816869 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,440,902 | -1.46 | 0.42 | ●○○○○ -0.58 | -0.58223979463806 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,440,802 | -1.14 | 0.53 | ●○○○○ -0.41 | -0.412853608667864 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,440,712 | -0.96 | 0.73 | ●○○○○ -0.32 | -0.322218653987657 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,440,800 | -0.53 | 0.86 | ●○○○○ -0.1 | -0.0993439972809974 | 23637626 |
Retrieved 11 of 11 entries in 2 ms
(Link to these results)