Bacterial taxon 909946
Locus STM474_4418
Protein WP_000977979.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 245 aa, Gene yjbg, UniProt E8X8Y6
>WP_000977979.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MMKRTISALALAFVASSAFASGTVTVFTQGNSEPKTLTDAERLLDLVGQPRLATSWWPAAVIGEEQATVTARQQQQELLGRLAVLSAEEDGDAAAAINTLRRQIQAVKVTGRQFVNLDPDVVRVSERGNPPLQGHYMLWVGPQPTQVTLFGLISQPGSQPFVPGRDVASYLEDQRLLSGADRSYAWVVYPDGRSQKAPVAYWNKRHIEPMPGSIIFVGFADSLWRGTPEAINADILHTLTQRIPE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,465,052 | -0.24 | 0.94 | ○○○○○ 0.05 | 0.0511485422568084 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,464,723 | 0.24 | 0.73 | ○○○○○ 0.3 | 0.299698720206032 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,465,052 | 0.48 | 0.55 | ○○○○○ 0.42 | 0.423978317871064 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,464,723 | 0.54 | 0.98 | ○○○○○ 0.46 | 0.458543662236291 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,465,052 | 1.17 | 0.58 | ○○○○○ 0.78 | 0.783870493570024 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,464,723 | 1.27 | 0.42 | ○○○○○ 0.84 | 0.835612351542651 | 23637626 |
Retrieved 6 of 6 entries in 1.7 ms
(Link to these results)