Bacterial taxon 909946
Locus STM474_4450
Protein WP_014344259.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 63 aa, Gene ssb, UniProt E8X9Q5
>WP_014344259.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MNFGWIMMCRGESARGDKRHFSVRYALLFFERDTKTIIPGKKMPGLHQAFQQTRTIAKMQITL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,498,170 | -4.48 | 3.8e-11 | ●●●○○ -2.15 | -2.15192992613255 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,498,170 | 0.68 | 0.62 | ○○○○○ 0.53 | 0.531821528751764 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,498,170 | 1.84 | 0.28 | ○○○○○ 1.13 | 1.13446303256833 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)