Bacterial taxon 909946
Locus STM474_4464
Protein WP_001728421.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 52 aa, Gene yjcD, UniProt E8X9R9
>WP_001728421.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MRSLFAMFFMMERGIMPRFHLLQINAKGNVMCPENENGRPTPPVFQNEGRAR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,528,787 | -0.4 | 0.76 | ●○○○○ -0.03 | -0.0289779315299838 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,528,787 | 0.06 | 1 | ○○○○○ 0.21 | 0.210032928836808 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,528,787 | 0.18 | 0.82 | ○○○○○ 0.27 | 0.27075657537629 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)