Bacterial taxon 909946
Locus STM474_4511
Protein WP_001576552.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 73 aa, Gene n/a, UniProt E8X9W6
>WP_001576552.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MNASPPLKLPDIATPSTRRSIYLPRCMPFLAESVNIYIQDKPYHKLTSDLIPHANYLHEIKELFSKRLKAIIT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,582,786 | -1.12 | 0.033 | ●○○○○ -0.4 | -0.401986934599183 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,582,786 | -2.18 | 0.062 | ●○○○○ -0.96 | -0.957569060573601 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,582,786 | -1.27 | 0.44 | ●○○○○ -0.48 | -0.482968266891352 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)