Bacterial taxon 909946
Locus STM474_4593
Protein WP_001119448.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 211 aa, Gene ytfB, UniProt E8XAS1
>WP_001119448.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MPGRFELKPTLAKIWHAPDNFRIMEPLPPMHRRGIIIAAIVLVIGFLLPASETSDSPVVTREAQLDLQSQSQPPTEAQLQAQLVAPQNDPDQVAPVAPEPIQEGQPEEQNQPQTQPFQQDSGIGQQWRSYRVESGKTLAQLFRDHGLPPTDVYAMAQVEGAGKPLSNLKNGQMIKIRQNASGVVTGLTIDGDNGQQVLFTRQPDGSFIRAQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,654,034 | 1.72 | 0.019 | ○○○○○ 1.07 | 1.06854389825326 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,653,980 | 2.32 | 1.3e-5 | ○○○○○ 1.38 | 1.38269631065244 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,654,034 | -1.45 | 0.17 | ●○○○○ -0.58 | -0.576816220720501 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,653,696 | -0.66 | 0.26 | ●○○○○ -0.16 | -0.163924582319605 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,654,034 | 0.45 | 0.97 | ○○○○○ 0.41 | 0.409941923823091 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,653,696 | 0.69 | 0.9 | ○○○○○ 0.54 | 0.535400483273129 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,653,938 | 0.94 | 0.56 | ○○○○○ 0.66 | 0.664724320897418 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,653,938 | 0.99 | 0.73 | ○○○○○ 0.69 | 0.69047547357821 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,653,980 | 1.16 | 0.64 | ○○○○○ 0.78 | 0.778480307434598 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,653,980 | 1.16 | 0.39 | ○○○○○ 0.78 | 0.781861844983551 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,654,222 | 1.17 | 0.16 | ○○○○○ 0.79 | 0.786058625633598 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,653,696 | 1.43 | 0.52 | ○○○○○ 0.92 | 0.922004859632696 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,654,222 | 1.56 | 0.42 | ○○○○○ 0.99 | 0.987902727490568 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,654,222 | 1.67 | 0.45 | ○○○○○ 1.04 | 1.04450288374746 | 23637626 |
Retrieved 14 of 14 entries in 1.1 ms
(Link to these results)