Bacterial taxon 909946
Locus STM474_4637
Protein WP_000435389.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 120 aa, Gene n/a, UniProt E8XBJ3
>WP_000435389.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MEQITVVIGDRLGKGQKVAAGVEKAGGRAVVVPGVAADMKLGDVMKAENATFGISFCGSGGAGAITAQNKHGYKAKYGMRSVDEGVTAINEGCNVLGFGFMDKEELGERLVQAWQKKYGA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,705,203 | -3.47 | 0.0011 | ●●○○○ -1.62 | -1.6233308945926 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,705,203 | -0.76 | 0.19 | ●○○○○ -0.22 | -0.216170428998557 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,705,203 | 0.62 | 0.63 | ○○○○○ 0.5 | 0.498021491741866 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)