Bacterial taxon 909946
Locus STM474_4676
Protein WP_010989098.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 39 aa, Gene n/a, UniProt E8XBN1
>WP_010989098.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MDFELQAGGKTVKPRSLHQVSDRGEQAQPTHLQLERRRV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,742,588 | -2.38 | 0.03 | ●●○○○ -1.06 | -1.0594566549298 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,742,588 | -1.54 | 0.12 | ●○○○○ -0.62 | -0.621800141175769 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,742,588 | -0.25 | 0.75 | ○○○○○ 0.05 | 0.0490308547160152 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)