Bacterial taxon 909946
Locus STM474_4696
Protein WP_000233467.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 104 aa, Gene n/a, UniProt E8XCD8
>WP_000233467.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MVHLALYASLDYRCDSTSALQTIVREPWPITYYLKALSDEIGEPSKKHLDRYLEPFVVSITDRSAWLAIIGGIKGLDGLDKKNISYESLDDPEVQKIYMTYRSE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,772,726 | -8.03 | 1.1e-44 | ●●●●○ -3.99 | -3.9926239641137 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,772,726 | -4.89 | 6.4e-7 | ●●●○○ -2.36 | -2.36398402132131 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,772,726 | -4.28 | 4.7e-5 | ●●●○○ -2.04 | -2.04379476638189 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)