Bacterial taxon 909946
Locus STM474_4803
Protein WP_000749515.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 104 aa, Gene n/a, UniProt E8XDD1
>WP_000749515.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MKKSPLCCYLFCAAMSASSAALAATAPVSAGVIHFKGQIVEYGCNLAPHDRNIEVSCLRNNIPHLQTVATPSGNAISLMNGIATVRHVSLKDHPEIQSLIVQYR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,875,531 | -0.01 | 0.95 | ○○○○○ 0.17 | 0.169456782968099 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,875,531 | 0.58 | 0.89 | ○○○○○ 0.48 | 0.475824166539595 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,875,531 | 0.66 | 0.67 | ○○○○○ 0.52 | 0.5188894538258 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)