Bacterial taxon 909946
Locus STM474_3700
Protein WP_000724553.1
IclR family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 251 aa, Gene n/a, UniProt E8XEN6
>WP_000724553.1|Salmonella enterica Serovar Typhimurium ST4 74|IclR family transcriptional regulator
MKKITTSIPALDKIMRVFAYLLECDGATFTQIHQNSGIAKSSTSSLLNGMVEHGLLRQEKDKYYLGLRLYELGNKAAEQYDIKKIALPILEEIRDNTGLTCHLGVLEGDAPIYLLKVESPQAIVIRSWEGKRLSLHSSGLGKVLIAWLSGEELEELLPPDQILTRFTDTTITDVNILKQELAGIRRRGWGYDNEEDSLGVRCIAVPVFNTQGKVIAALSVSGVTFQIPDDKRESLATLMMDASRSLTRLMC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,719,908 | -5.93 | 2.2e-7 | ●●●○○ -2.9 | -2.90300353587496 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,719,326 | -5.89 | 2.7e-7 | ●●●○○ -2.88 | -2.88393390926259 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,719,326 | -0.43 | 0.51 | ●○○○○ -0.04 | -0.0448372215199979 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,719,908 | 2.25 | 0.57 | ○○○○○ 1.35 | 1.34666056144479 | 23637626 |
Retrieved 4 of 4 entries in 1.1 ms
(Link to these results)