Bacterial taxon 909946
Locus STM474_4163
Protein WP_000378902.1
IMPACT family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 204 aa, Gene yigz, UniProt E8XJH3
>WP_000378902.1|Salmonella enterica Serovar Typhimurium ST4 74|IMPACT family protein
MDSWLIPAAPVTVVEEIKKSRFITLLAHTDGVDAAKAFVESVRAEHPDARHHCVAWVAGAPDDSQQLGFSDDGEPAGTAGKPMLAQLMGSGVGEITAVVVRYYSGILLGTGGLVKAYGGGVNQALRQLATQRKTPLTEYTLQCEYGQLAGIEALLGQFAGKIVSSDYQASVRLRVALPFAHVNAFSTKLADFSRGSLQLLAIEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,214,570 | -0.69 | 0.34 | ●○○○○ -0.18 | -0.181174824076775 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,214,980 | 0.37 | 0.95 | ○○○○○ 0.37 | 0.367809557912021 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,214,570 | 0.53 | 0.94 | ○○○○○ 0.45 | 0.452672737114661 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,214,570 | 0.64 | 0.73 | ○○○○○ 0.51 | 0.508482310449373 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,214,980 | 0.83 | 0.71 | ○○○○○ 0.61 | 0.60987051566974 | 23637626 |
Retrieved 5 of 5 entries in 1.5 ms
(Link to these results)