Bacterial taxon 909946
Locus STM474_4622
Protein WP_000172704.1
inositol 2-dehydrogenase IolG1
Salmonella enterica Serovar Typhimurium ST4 74
Length 336 aa, Gene iolG, UniProt E8XBH8
>WP_000172704.1|Salmonella enterica Serovar Typhimurium ST4 74|inositol 2-dehydrogenase IolG1
MTLKAGIVGIGMIGSDHLRRLANTVSGVEVVAVCDIVAGRAQAALDKYAIEAKDYNDYHDLINDKDVEVVIITASNEAHADVAVAALNANKYVFCEKPLAVTAADCQRVIEAEQKNGKRMVQIGFMRRYDKGYVQLKNIIDSGEIGQPLMVHGRHYNASTVPEYKTPQAIYETLIHEIDVMHWLLNEDYKTVKVYFPRQSSLVTTLRDPQLVVMETTSGINIVVEVFVNCQYGYDIHCDVTGEKGMAELPTVASAAVRKAAKYSTDILVDWKQRFIDAYDIEFQDFFDRLNAGLPPAGPTSWDGYLAAVTADACVKSQETGNTEIVELPSKPDFYK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,689,001 | -2.6 | 0.0045 | ●●○○○ -1.17 | -1.17111137465771 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,688,602 | -1.22 | 0.017 | ●○○○○ -0.46 | -0.456344852430205 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,688,561 | -1.18 | 0.027 | ●○○○○ -0.44 | -0.437359381287913 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,689,089 | 1.68 | 0.024 | ○○○○○ 1.05 | 1.04866041562942 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,689,001 | -0.86 | 0.7 | ●○○○○ -0.27 | -0.266973352450878 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,688,602 | -0.69 | 0.55 | ●○○○○ -0.18 | -0.18147507263463 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,688,573 | -0.62 | 0.41 | ●○○○○ -0.15 | -0.146343620174612 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,688,524 | -0.56 | 0.69 | ●○○○○ -0.11 | -0.112695058960207 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,688,602 | -0.46 | 0.87 | ●○○○○ -0.06 | -0.0643027513462069 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,689,031 | -0.32 | 0.92 | ○○○○○ 0.01 | 0.0102702216919399 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,688,573 | 0.19 | 0.98 | ○○○○○ 0.28 | 0.277457504600681 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,689,031 | 0.24 | 0.78 | ○○○○○ 0.3 | 0.300229975531858 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,688,561 | 0.35 | 0.95 | ○○○○○ 0.36 | 0.357414777341876 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,689,001 | 0.39 | 0.63 | ○○○○○ 0.38 | 0.379424030120851 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,689,089 | 0.53 | 0.68 | ○○○○○ 0.45 | 0.452311056221719 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,689,089 | 0.73 | 0.84 | ○○○○○ 0.56 | 0.558365033140684 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,688,524 | 0.77 | 0.94 | ○○○○○ 0.58 | 0.578850386467677 | 23637626 |
Retrieved 17 of 17 entries in 1.3 ms
(Link to these results)