Bacterial taxon 909946
Locus STM474_2079
Protein WP_000532847.1
integrase
Salmonella enterica Serovar Typhimurium ST4 74
Length 329 aa, Gene n/a, UniProt E8XB66
>WP_000532847.1|Salmonella enterica Serovar Typhimurium ST4 74|integrase
MGRKRAPGNEWMPKGVFFRPSGYYWKPGGSTENIAPADATKAEVWVAYEKKVEGRKNRITFTQLWRKFLASADYADLAPRTQKDYLAHEKYILAVFGDAEAKAIKPEHIRRYMDARGQKSRVQANHEHSSMSRVFRWSYQRGYVPGNPCVGVDKFPKPQRDRYITDEEYRAIYNNATPAVRAAMEIAYLCAARVSDVLKMNWNQILEKGIFIQQGKTGVKQIKSWTDRLRDAVEICREWGEEGPVIRTMYGERYSYKGFNEAWRKARKAAGDDLGRPLDCTFHDLKAKGISDYEGTAKDKQKYSGHKTESQVLVYDRKVKMSPTLDRKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,079,534 | -9.43 | 2.7e-10 | ●●●●● -4.72 | -4.7221185748826 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,079,534 | -9.31 | 1.2e-66 | ●●●●● -4.66 | -4.65938360684376 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,079,534 | -6.02 | 9.3e-7 | ●●●○○ -2.95 | -2.95089653484692 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,079,760 | 1.94 | 0.0092 | ○○○○○ 1.19 | 1.18659252418715 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,079,760 | 1.17 | 0.64 | ○○○○○ 0.79 | 0.786665903960952 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,079,760 | 2.05 | 0.18 | ○○○○○ 1.24 | 1.24321619657262 | 23637626 |
Retrieved 6 of 6 entries in 1.2 ms
(Link to these results)