Bacterial taxon 909946
Locus STM474_2645
Protein WP_000028952.1
iron-sulfur cluster assembly protein IscA
Salmonella enterica Serovar Typhimurium ST4 74
Length 107 aa, Gene iscA, UniProt E8XGN2
>WP_000028952.1|Salmonella enterica Serovar Typhimurium ST4 74|iron-sulfur cluster assembly protein IscA
MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,678,489 | -1.01 | 0.13 | ●○○○○ -0.35 | -0.346935448587214 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,678,489 | 0.61 | 0.99 | ○○○○○ 0.49 | 0.491840792272429 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,678,489 | 1.53 | 0.49 | ○○○○○ 0.97 | 0.973957140295642 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)