Bacterial taxon 909946
Locus STM474_3935
Protein WP_000106461.1
isochorismatase family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 226 aa, Gene slsA, UniProt E8XGV9
>WP_000106461.1|Salmonella enterica Serovar Typhimurium ST4 74|isochorismatase family protein
MSTPANFNGQRPAIDANDAVMLLIDHQSGLFQTVGDMPMPELRARAAALAKIATLCNMPVITTASVPQGPNGPLIPEIHANAPHAQYVARKGEINAWDNADFVQAVKATGRKTLIIAGTITSVCMAFPAISAVAEGYKVFAVIDASGTYSKMAQEITMARVVQAGVVPMDTAAVASELQRTWNREDAAEWADVYTKIFPAYQLLIESYTKAQEVVKNNELLDSQRA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,981,528 | -2.54 | 0.00035 | ●●○○○ -1.14 | -1.14049857618994 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,981,528 | -0.98 | 0.38 | ●○○○○ -0.33 | -0.333961800959777 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,981,159 | -0.43 | 0.89 | ●○○○○ -0.04 | -0.0438569241013663 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,981,159 | -0.1 | 0.91 | ○○○○○ 0.12 | 0.123992976760717 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,981,528 | -0.09 | 0.98 | ○○○○○ 0.13 | 0.128439753960189 | 23637626 |
Retrieved 5 of 5 entries in 1 ms
(Link to these results)