Bacterial taxon 909946
Locus STM474_2937
Protein WP_000492669.1
L-alanine exporter AlaE
Salmonella enterica Serovar Typhimurium ST4 74
Length 149 aa, Gene alaE, UniProt E8XK43
>WP_000492669.1|Salmonella enterica Serovar Typhimurium ST4 74|L-alanine exporter AlaE
MFSPQSRLRHAVADTFAMVVYCSVVNMLIEIFLSGMSFEQSLSSRLVAIPVNILIAWPYGVYRDLIMRVARKASPAGWAKNLADVLAYVTFQSPVYIIILLTVGAGWHQIVAAVSSNIVVSMLMGAVYGYFLDYCRRLFKVSSYHQAKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,970,937 | -1.48 | 0.014 | ●○○○○ -0.59 | -0.590161584478576 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,970,937 | -1.98 | 0.1 | ●○○○○ -0.85 | -0.85166091397978 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,970,937 | -1.59 | 0.1 | ●○○○○ -0.65 | -0.65015026618333 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)