Bacterial taxon 909946
Locus STM474_3119
Protein WP_000440819.1
L-fuculose-phosphate aldolase
Salmonella enterica Serovar Typhimurium ST4 74
Length 215 aa, Gene fucA, UniProt E8X8Q8
>WP_000440819.1|Salmonella enterica Serovar Typhimurium ST4 74|L-fuculose-phosphate aldolase
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGLLITPTGIPYEKLTESHIVFIDADGQHEQGKLPSSEWRFHMAAYQTRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGGNSIPCAPYATFGTRELSDHVAVALKNRKATLLQHHGLIACEENLDKALWLAHEVEVLAQLYLSTLAIVDPVPVLDDEAIAIVLEKFKTYGLRIEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,147,736 | -3.86 | 0.00027 | ●●○○○ -1.83 | -1.82605954106174 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,147,736 | -3.78 | 0.00026 | ●●○○○ -1.79 | -1.78790890445827 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,147,736 | -1.6 | 0.014 | ●○○○○ -0.65 | -0.6524668933273 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)