Bacterial taxon 909946
Locus STM474_3848
Protein WP_001244031.1
L-ribulose-5-phosphate 3-epimerase
Salmonella enterica Serovar Typhimurium ST4 74
Length 286 aa, Gene sgbU, UniProt E8XFZ0
>WP_001244031.1|Salmonella enterica Serovar Typhimurium ST4 74|L-ribulose-5-phosphate 3-epimerase
MRNHPLGIYEKALAKDLSWPERLVLAKSCGFDFVEMSVDETDERLSRLEWTPAQRASLVNAMLESGVAIPSMCLSAHRRFPFGSRDEAVRQRAREIMTKAIRLARDLGIRTIQLAGYDVYYEEHDEGTQQRFAEGLAWAVEQAAAAQVMLAVEIMDTAFMNSISKWKKWDEMLSSPWFTVYPDVGNLSAWGNDVTAELKLGIDRIAAIHLKDTLPVTGDSPGQFRDVPFGEGCVDFVGIFKTLHELNYRGSFLIEMWTEKASEPVLEIIQARRWIESRMQEGGFTC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,884,905 | 0.7 | 0.85 | ○○○○○ 0.54 | 0.53906435146407 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,884,905 | 1.33 | 0.058 | ○○○○○ 0.87 | 0.869631203368781 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,884,905 | 1.51 | 0.25 | ○○○○○ 0.96 | 0.959756469863585 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)