Bacterial taxon 909946
Locus STM474_1848
Protein WP_001738311.1
L-serine ammonia-lyase
Salmonella enterica Serovar Typhimurium ST4 74
Length 454 aa, Gene sdaA, UniProt E8X8J7
>WP_001738311.1|Salmonella enterica Serovar Typhimurium ST4 74|L-serine ammonia-lyase
MISLFDMFKVGIGPSSSHTVGPMKAGKQFVDDLVEKGLLDNVTRVAVDVYGSLSLTGKGHHTDIAIIMGLAGNEPATVDIDSIPGFIRDVETRERLLLAQGRHEVDFPKDDGMRFHNGNLPLHENGMQIHAWHDDTVIYSKTYYSIGGGFIVDEEHFGQEATNEVTVPYPFKSAKEMLEYCNSTGLSLSGMVMQNELALHSKKEIEEYFGHVWQTMQACIDRGMNTEGVLPGPLRVPRRASALRRMLVSSDKLSSDPMNVIDWVNMFALAVNEENAAGGRVVTAPTNGACGIVPAVLAYYDHFIESVSPDIYTRYFLAAGAIGALYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGASPEQVCVAAEIGMEHNLGLTCDPVAGQVQVPCIERNAIASVKAINAARMAMHRTSAPRVSLDKVIETMYETGKDMNAKYRETSRGGLAIKVQCD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,882,299 | 2,71 | 0,00072 | ○○○○○ 1,58 | 1.5819259464279 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,881,502 | 0,02 | 1 | ○○○○○ 0,19 | 0.187303315911043 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,880,990 | 0,25 | 0,97 | ○○○○○ 0,3 | 0.304568861462545 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,882,075 | 0,4 | 0,53 | ○○○○○ 0,38 | 0.383357665692015 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,880,990 | 0,6 | 0,44 | ○○○○○ 0,49 | 0.490858574947269 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,881,502 | 0,64 | 0,31 | ○○○○○ 0,51 | 0.508652957786473 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,881,502 | 0,67 | 0,87 | ○○○○○ 0,52 | 0.524733153873107 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,882,075 | 0,77 | 0,92 | ○○○○○ 0,57 | 0.574588501408141 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,882,299 | 1,01 | 0,4 | ○○○○○ 0,7 | 0.701569815740513 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,882,299 | 1,76 | 0,31 | ○○○○○ 1,09 | 1.09319977723588 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,882,075 | 2,63 | 0,11 | ○○○○○ 1,55 | 1.54540958910135 | 23637626 |
Retrieved 11 of 11 entries in 1,3 ms
(Link to these results)