Bacterial taxon 909946
Locus STM474_1442
Protein WP_001237787.1
lactoylglutathione lyase
Salmonella enterica Serovar Typhimurium ST4 74
Length 135 aa, Gene gloA, UniProt E8XHC8
>WP_001237787.1|Salmonella enterica Serovar Typhimurium ST4 74|lactoylglutathione lyase
MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVESYDMGNAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKIELIEAKDAGRGLGN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,469,415 | 2.64 | 0.0023 | ○○○○○ 1.55 | 1.54658951317654 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,469,415 | 0.31 | 0.97 | ○○○○○ 0.34 | 0.336885083885254 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,469,415 | 1.72 | 0.23 | ○○○○○ 1.07 | 1.06883313058791 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)