Bacterial taxon 909946
Locus STM474_3575
Protein WP_000008119.1
large-conductance mechanosensitive channel protein MscL
Salmonella enterica Serovar Typhimurium ST4 74
Length 137 aa, Gene mscL, UniProt E8XDV4
>WP_000008119.1|Salmonella enterica Serovar Typhimurium ST4 74|large-conductance mechanosensitive channel protein MscL
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFTLREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEEVLLGEIRDLLKEQNNRS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,602,842 | -1.4 | 0.17 | ●○○○○ -0.55 | -0.550053872433723 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,602,842 | -0.42 | 0.89 | ●○○○○ -0.04 | -0.0431001298722817 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,603,059 | 0.48 | 0.92 | ○○○○○ 0.43 | 0.426281523326033 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,603,059 | 0.96 | 0.55 | ○○○○○ 0.68 | 0.675754658039498 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,603,059 | 1.4 | 0.054 | ○○○○○ 0.91 | 0.905726803598193 | 23637626 |
Retrieved 5 of 5 entries in 0.9 ms
(Link to these results)