Bacterial taxon 909946
Locus STM474_1271
Protein WP_000457190.1
leucine efflux protein LeuE
Salmonella enterica Serovar Typhimurium ST4 74
Length 212 aa, Gene yeaS, UniProt E8XFJ6
>WP_000457190.1|Salmonella enterica Serovar Typhimurium ST4 74|leucine efflux protein LeuE
MFAEYGVLNYWTYLVGAIFIVLVPGPNTLFVLKNSVGRGVKGGYLAACGVFIGDAILMFLAYAGVATLIKTTPVLFNIVRYLGAFYLLYLGAKILYATLTSKGRAATETVVPFGAIFKRALILSLTNPKAILFYVSFFVQFIDVTAPHTGVSFFILATTLEIVSFCYLSFLILSGAFVTHYIGTKKKLAKVGNSLIGLLFVGFAARLATLQS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,308,084 | -2.2 | 0.05 | ●○○○○ -0.96 | -0.964814543215915 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,308,084 | -0.8 | 0.13 | ●○○○○ -0.24 | -0.23860160473622 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,308,084 | -0.23 | 0.95 | ○○○○○ 0.06 | 0.0558853645184688 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)