Bacterial taxon 909946
Locus STM474_0946
Protein WP_000228469.1
leucine-responsive transcriptional regulator Lrp
Salmonella enterica Serovar Typhimurium ST4 74
Length 164 aa, Gene lrp, UniProt E8XCR6
>WP_000228469.1|Salmonella enterica Serovar Typhimurium ST4 74|leucine-responsive transcriptional regulator Lrp
MVDSKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNAAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 993,475 | 1.9 | 0.014 | ○○○○○ 1.16 | 1.16304751236588 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 993,475 | 2.09 | 0.96 | ○○○○○ 1.26 | 1.25992267375094 | 23637626 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)