Bacterial taxon 909946
Locus STM474_2323
Protein WP_000806401.1
LexA family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 167 aa, Gene n/a, UniProt E8XDR9
>WP_000806401.1|Salmonella enterica Serovar Typhimurium ST4 74|LexA family transcriptional regulator
MKQANEWIEWYVTTFRDVSTQEGETYLSAVQSKRRTIAMGFPSPASDYVETRISLDQQLISQPAATYFMRASRSHFREGIIQGALLVVDASLSACDGSLLICAIDGEFRIKRYRTHPQPHLINLENGRKEALPEDGDGYNSSHAIFGVITYIINDARNAEFDDCPVM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,328,943 | -0.9 | 0.23 | ●○○○○ -0.29 | -0.291800034565013 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,328,943 | 0.42 | 0.94 | ○○○○○ 0.4 | 0.396805350029847 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,328,782 | 0.52 | 0.93 | ○○○○○ 0.45 | 0.448739596969743 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,328,943 | 0.58 | 0.82 | ○○○○○ 0.48 | 0.476891960179918 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,328,782 | 0.68 | 0.86 | ○○○○○ 0.53 | 0.530543381489981 | 23637626 |
Retrieved 5 of 5 entries in 1.7 ms
(Link to these results)