Bacterial taxon 909946
Locus STM474_1240
Protein WP_001520581.1
lipoprotein
Salmonella enterica Serovar Typhimurium ST4 74
Length 173 aa, Gene envE, UniProt E8XFH0
>WP_001520581.1|Salmonella enterica Serovar Typhimurium ST4 74|lipoprotein
MTLLSGKTTLVLCLSSILCGCTTNGLPTPYSINLSFPVITQNQINSGGYYINDAEQIRTTDGLCLDAGPDQQNRLTLRECKHVQSQLFSFHRDRITQGEKCLDAAGQGTKEGTPIILYSCTGNDNQRWLTDDNKIKGKQSRKCLGTNSIIVRKGDPVVLADCDFSRALEFTIR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,287,077 | -4.51 | 0.00012 | ●●●○○ -2.16 | -2.16309614768421 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,287,077 | -2.93 | 0.0078 | ●●○○○ -1.34 | -1.34391633096519 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,287,077 | -2.19 | 2.6e-5 | ●○○○○ -0.96 | -0.960053366651717 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)