Bacterial taxon 909946
Locus STM474_1347
Protein WP_001213256.1
lipoprotein
Salmonella enterica Serovar Typhimurium ST4 74
Length 154 aa, Gene nlpC, UniProt E8XGE9
>WP_001213256.1|Salmonella enterica Serovar Typhimurium ST4 74|lipoprotein
MRFWLLVITALFLAGCSTHRAPAPNARLSDSITVIAGLNDQLQSWRGTPYRYGGMSRRGVDCSGFVVVTMRDKFDLQLPRDTREQSKIGTRIDKDELLPGDLVFFKTGSGESGLHVGIYDTNNEFIHASTSRGVMRSSLDNVYWRKNFWQARRI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,379,269 | -0.94 | 0.45 | ●○○○○ -0.31 | -0.311724078784564 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,379,269 | 0.03 | 1 | ○○○○○ 0.2 | 0.195155824493756 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,379,269 | 0.56 | 0.3 | ○○○○○ 0.47 | 0.470245917847853 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)