Bacterial taxon 909946
Locus STM474_3812
Protein WP_000395013.1
long polar fimbrial protein LpfA
Salmonella enterica Serovar Typhimurium ST4 74
Length 178 aa, Gene lpfA, UniProt E8XFV5
>WP_000395013.1|Salmonella enterica Serovar Typhimurium ST4 74|long polar fimbrial protein LpfA
MEFLMKKVVFALSALAVVSTSAFAAESGDGTIKFTGEIVDAPCVVSTDSQNQEVVLGQVKKNIFKAIGDKSSSKPFQIKLEDCDITSNTKVNVSFNGVGDTDDATLVSVNTEAGAATGVGIGIYDNANKLVEMNTGKSTTTLAAGQTVLYYTANYVATKDTVTTGYGNAEVDFNLSYE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,848,974 | -3.79 | 6.4e-7 | ●●○○○ -1.79 | -1.79105888113045 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,848,974 | -2.81 | 0.00039 | ●●○○○ -1.28 | -1.28241593397047 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,848,931 | -2.55 | 0.00038 | ●●○○○ -1.15 | -1.1464301271509 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,848,931 | -1.19 | 0.29 | ●○○○○ -0.44 | -0.441053441398186 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,848,974 | -1.17 | 0.56 | ●○○○○ -0.43 | -0.430864099654968 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,848,931 | 0.04 | 1 | ○○○○○ 0.2 | 0.196233363074845 | 23637626 |
Retrieved 6 of 6 entries in 0.8 ms
(Link to these results)