Bacterial taxon 909946
Locus STM474_1266
Protein WP_001738208.1
LuxR family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 197 aa, Gene n/a, UniProt E8XFJ1
>WP_001738208.1|Salmonella enterica Serovar Typhimurium ST4 74|LuxR family transcriptional regulator
MTGSASSVLKTDTRLLSENLFLNYGLESLFKDVAIIAGNVNYIIFDIDDYYTVQQYITSTFKTVLIGIVTHNEYNFIDEHHVIYRIKVDASIAEWRELLILAAAGQFFPRSEKVRLTANERNVLAMLVKGMDIRQISCELNVHLKTIYSVRYHVLTKLGCRTVLDYQILSVSKAFTHWLTINNVDNVISRVNSKVIA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,304,383 | -6.01 | 3.1e-5 | ●●●○○ -2.94 | -2.94203000766339 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,304,459 | -5.92 | 6.2e-21 | ●●●○○ -2.9 | -2.89889110024487 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,304,383 | -4.56 | 1.5e-13 | ●●●○○ -2.19 | -2.19001812033379 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,304,459 | -4.07 | 0.00032 | ●●○○○ -1.93 | -1.93466751972977 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,304,383 | -0.88 | 0.76 | ●○○○○ -0.28 | -0.281730566239169 | 23637626 |
Retrieved 5 of 5 entries in 0.4 ms
(Link to these results)