Bacterial taxon 909946
Locus STM474_2452
Protein WP_000754423.1
lysine/arginine/ornithine ABC transporter substrate-binding protein ArgT
Salmonella enterica Serovar Typhimurium ST4 74
Length 260 aa, Gene argT, UniProt E8XF08
>WP_000754423.1|Salmonella enterica Serovar Typhimurium ST4 74|lysine/arginine/ornithine ABC transporter substrate-binding protein ArgT
MKKTVLALSLLIGLGATAASYAALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,463,720 | -3.93 | 1.0e-13 | ●●○○○ -1.87 | -1.8654235663811 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,463,720 | -3.25 | 0.0045 | ●●○○○ -1.51 | -1.50924489497425 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,463,720 | -1.9 | 0.12 | ●○○○○ -0.81 | -0.80935942595895 | 23637626 |
Retrieved 3 of 3 entries in 1.8 ms
(Link to these results)