Bacterial taxon 909946
Locus STM474_2059
Protein WP_001050825.1
lysis protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 161 aa, Gene n/a, UniProt E8XB47
>WP_001050825.1|Salmonella enterica Serovar Typhimurium ST4 74|lysis protein
MNLLPVLLKKYWLQLSVTLLIAVLAWTTDHYRDNAIQYKSQRDTASHSLTLANETISDMEVRQRDVAALDARYTKELADAKAENDALRDDVAAGRRRLLVNATCPAVSTGKSTSAARVDNAARPRLADSAQRDYFTLKERVTTMQKQLEGAQDYIRTQCLK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,062,721 | 0.5 | 0.92 | ○○○○○ 0.43 | 0.434341692364057 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,062,721 | 0.58 | 0.29 | ○○○○○ 0.48 | 0.476148337330138 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,062,721 | 0.59 | 0.44 | ○○○○○ 0.48 | 0.482375599596216 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)