Bacterial taxon 909946
Locus STM474_3742
Protein WP_000964735.1
lysoplasmalogenase
Salmonella enterica Serovar Typhimurium ST4 74
Length 208 aa, Gene yhhN, UniProt E8XF87
>WP_000964735.1|Salmonella enterica Serovar Typhimurium ST4 74|lysoplasmalogenase
MLWSFIAVCLSAWLYVDASYRGPAWQRWVFKPVTLLLLLLLAWQAPMFDAISYLVLAGLCASLVGDALTLLPRQRLLYAVGAFFLSHLLYTIYFASQMTLSFFWPLPLALLIVGALLIAVIWTRLEELRWPVCTFIAMTLVMVWLAGELWFFRPTAPALSAFTGATLLFIGNIVWLGSHYRRRFRADNAIAAACYFAGHFLIVRSLYL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,763,136 | -2.94 | 0.00094 | ●●○○○ -1.35 | -1.34909086283379 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,763,136 | -0.38 | 0.5 | ●○○○○ -0.02 | -0.0228264113161697 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,763,136 | 1.02 | 0.72 | ○○○○○ 0.71 | 0.705652598499954 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)