Bacterial taxon 909946
Locus STM474_2521
Protein WP_000438890.1
LysR family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 294 aa, Gene xapR, UniProt E8XFM7
>WP_000438890.1|Salmonella enterica Serovar Typhimurium ST4 74|LysR family transcriptional regulator
MERAHRIDLKLLRYFLAVAEELHFGRAAARLNMSQPPLSIHIKELEQQLGTLLFIRHSRSVALTHAGKVLMEESRRLLASANQALARVEQIGRGEAGRIELGVVGTALWGRMRPAMRHFLKANPNVEVLFREKSPGMQMALLERRELDAGIWRMAIEPAVGFTSIRLHESAFMVAVPEDHDLASRDSVPLAALRNEYFVTLPSVHSDWGFLQRVCQQAGFSPMIIREVVEPQTVLAMISMGIGITLMADGYAQMSWPGVVFRPLEERIPADLYIVYDQQQATPALEKLVAALTV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,530,884 | -3.9 | 3.4e-11 | ●●○○○ -1.85 | -1.85032831298329 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,530,884 | -2.02 | 0.067 | ●○○○○ -0.87 | -0.869468392378339 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,530,884 | 0.56 | 0.94 | ○○○○○ 0.47 | 0.468182743292786 | 23637626 |
Retrieved 3 of 3 entries in 0.6 ms
(Link to these results)