Bacterial taxon 909946
Locus STM474_3910
Protein WP_001050870.1
LysR family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 300 aa, Gene n/a, UniProt E8XGT6
>WP_001050870.1|Salmonella enterica Serovar Typhimurium ST4 74|LysR family transcriptional regulator
MNLLQMDMNLLKVLYVLLETSSTGKTAQKLALSPSAVSHALMRLRDALNDPLFRREGNRQIPTPYAQALRDKLAPVFVSLNEELFGDKENGSRCFRVVLPPALNALLTPVLAEKGHLHQAVIECLPFARRPWRDELLDSSVDLVLAIGDHQKQVSALHYERVGTTRLIAVYGAPLRSRLENATALNFADLQHYQHIYCLPWTKENNELDRQQARAGFERPLAFVCHDYSQLAPAVQSAPLMAIVPRPWYENLSDKRGLFVLPLAGEQAEGAIFMQYRASTVEWKRRLIDAIRRKLKTYYR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,950,432 | 1.03 | 0.64 | ○○○○○ 0.71 | 0.709531626050797 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,950,432 | 1.48 | 0.067 | ○○○○○ 0.95 | 0.945803508918915 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,950,432 | 1.98 | 0.85 | ○○○○○ 1.2 | 1.2034589513386 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)