Bacterial taxon 909946
Locus STM474_3211
Protein WP_000828345.1
LysR family transcriptional regulator ArgP
Salmonella enterica Serovar Typhimurium ST4 74
Length 297 aa, Gene argP, UniProt E8X9N5
>WP_000828345.1|Salmonella enterica Serovar Typhimurium ST4 74|LysR family transcriptional regulator ArgP
MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENMFGQPLLVRTVPPRPTEQGQKLLALLRQVELLEEEWLGDEQTGSTPLLLSLAVNADSLATWLLPALAPVLADSPIRLNLQVEDETRTQERLRRGEVVGAVSIQHQALPSCLVDKLGALDYLFVASKPFAERYFPNGVTRSSLLKAPAVAFDHLDDMHQAFLQQNFDLPPGSVPCHIVNSSEAFVQLARQGTTCCMIPHLQIEKELESGELINLTPGLLQRRMLYWHRFAPESRMMRKVTDALLEYGHKVLRQD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,246,787 | -0.12 | 0.97 | ○○○○○ 0.12 | 0.115674941477964 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,246,664 | 0.17 | 0.99 | ○○○○○ 0.27 | 0.266875566120466 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,246,787 | 0.32 | 0.52 | ○○○○○ 0.34 | 0.342070567062713 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,246,664 | 0.57 | 0.37 | ○○○○○ 0.47 | 0.474563887339466 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,246,664 | 1.35 | 0.19 | ○○○○○ 0.88 | 0.878951239271045 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,246,787 | 1.73 | 0.23 | ○○○○○ 1.08 | 1.07534892151719 | 23637626 |
Retrieved 6 of 6 entries in 1.9 ms
(Link to these results)