Bacterial taxon 909946
Locus STM474_4411
Protein WP_001270441.1
lytic transglycosylase domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 201 aa, Gene n/a, UniProt E8X8X9
>WP_001270441.1|Salmonella enterica Serovar Typhimurium ST4 74|lytic transglycosylase domain-containing protein
MRYQYVCLVCAMTFLSADAAEPPRASLQWRNEVIRTAREIWGLNAPVADFAGQLHQESGWAPDALSPAGAQGMAQFMPATAKWVSQLYPELHENKPFNPAWAIRALVQYDRQLWKSVLAKNSCQRMAFTLSAYNGGQGWVNRDKKLAAAKGLDASIWFEHVERVNAGRSAANWRENRHYPKAILYQHAPRYLQWGQASCIH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,457,946 | -1.16 | 0.48 | ●○○○○ -0.42 | -0.423254834972345 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,458,397 | -0.98 | 0.47 | ●○○○○ -0.33 | -0.332369376891543 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,457,946 | -0.93 | 0.06 | ●○○○○ -0.31 | -0.307106729548628 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,457,946 | 0.21 | 0.89 | ○○○○○ 0.29 | 0.288562583075555 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,458,397 | 0.28 | 0.97 | ○○○○○ 0.32 | 0.321266513925778 | 23637626 |
Retrieved 5 of 5 entries in 1.9 ms
(Link to these results)