Bacterial taxon 909946
Locus STM474_3375
Protein WP_000202966.1
M48 family peptidase
Salmonella enterica Serovar Typhimurium ST4 74
Length 165 aa, Gene ygiP, UniProt E8XBE9
>WP_000202966.1|Salmonella enterica Serovar Typhimurium ST4 74|M48 family peptidase
MTSLTYLQGYPEHLLAQVRALIAEQRLGAVLEKRYPGAHDYATDKALYHYTQELKSQFLRNAPPINKVMYDSKIHVLKNALGLHTAVSRVQGGKLKAKAEIRVATVFRNAPEPFLRMIVVHELAHLKEKDHNKAFYQLCCHMEPQYHQLEFDTRLWLTHQALSAQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,410,389 | -0.89 | 0.5 | ●○○○○ -0.28 | -0.284535390767386 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,410,389 | -0.34 | 0.95 | ●○○○○ -0 | -0.0000130085178872212 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,410,389 | 0.39 | 0.49 | ○○○○○ 0.38 | 0.379242526509479 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)