Bacterial taxon 909946
Locus STM474_4076
Protein WP_000840996.1
macrodomain Ori organization protein MaoP
Salmonella enterica Serovar Typhimurium ST4 74
Length 112 aa, Gene yifE, UniProt E8XIK9
>WP_000840996.1|Salmonella enterica Serovar Typhimurium ST4 74|macrodomain Ori organization protein MaoP
MAESFTTTNRYFDNKHYPRGFSRHGDFTIKEAQLLERHGHAFNDLDLGKREPVTEEEKLFVAVCRGEREPVTDAERVWSKYMTRIKRPKRFHTLSGGKPQVEGAEDYTEADD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,128,364 | -2.01 | 1.5e-5 | ●○○○○ -0.87 | -0.868859877043316 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,128,364 | -0.94 | 0.41 | ●○○○○ -0.31 | -0.312784121652655 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,128,364 | -0.74 | 0.86 | ●○○○○ -0.21 | -0.20912946028365 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)