Bacterial taxon 909946
Locus STM474_0688
Protein WP_001278615.1
magnesium/cobalt transporter CorC
Salmonella enterica Serovar Typhimurium ST4 74
Length 292 aa, Gene corc, UniProt E8XA26
>WP_001278615.1|Salmonella enterica Serovar Typhimurium ST4 74|magnesium/cobalt transporter CorC
MSDDNSHSSDTVNSKKGFFSLLLSQLFHGEPKNRDELLALIRDSGQNELIDEDTRDMLEGVMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAKDLLPFMRSDAEAFSMDKVLRTAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTIRALASIEDFNDAFGTHFSDEEVDTIGGLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQVHVRIPDDSPQPKLDE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 731,681 | -0.53 | 0.87 | ●○○○○ -0.1 | -0.0986666675521071 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 731,487 | -0.48 | 0.87 | ●○○○○ -0.07 | -0.0737385881997919 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 731,681 | -0.08 | 0.74 | ○○○○○ 0.14 | 0.13695041138252 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 731,487 | 0.39 | 0.95 | ○○○○○ 0.38 | 0.380103524872819 | 23637626 |
Retrieved 4 of 4 entries in 1.7 ms
(Link to these results)