Bacterial taxon 909946
Locus STM474_2265
Protein WP_000781183.1
maleylacetoacetate isomerase
Salmonella enterica Serovar Typhimurium ST4 74
Length 214 aa, Gene n/a, UniProt E8XD18
>WP_000781183.1|Salmonella enterica Serovar Typhimurium ST4 74|maleylacetoacetate isomerase
MKLYSFFNSSASYRVRIALALKGIDYQTVGVNIRIGQQNALAYRRMNPVGLVPTLVTDDGESLGQSLAIVDWLDRHFPQTPLLPTSDPARSQALEIVYAIACDIHPINNMRVLRYLTDELKVSEEDKKRWYAHWIQQGLSAVEQLLRKSQSGRFCVGDAPGLADCCLIPQWANALRMGCDLSGYPRCKAVYDACVQLPAFIAAAPENQQDKIPA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,271,292 | -0.58 | 0.42 | ●○○○○ -0.12 | -0.12338119742016 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,271,292 | 0.35 | 0.95 | ○○○○○ 0.36 | 0.35835925295027 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,271,292 | 1.53 | 0.34 | ○○○○○ 0.97 | 0.973309238574127 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)