Bacterial taxon 909946
Locus STM474_4421
Protein WP_001252085.1
maltose ABC transporter permease
Salmonella enterica Serovar Typhimurium ST4 74
Length 296 aa, Gene malG, UniProt E8X8Y9
>WP_001252085.1|Salmonella enterica Serovar Typhimurium ST4 74|maltose ABC transporter permease
MAMVQPKSQKLRLLITHLGLLIFIAAIMFPLLMVIAISLREGNFATGSLIPDKISWEHWRLALGFSVEHADGRVTPPPFPVLLWLWNSVKIAGITAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGQYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVDSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITLVFLLAQRWLVNGLTAGGVKG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,468,507 | -0.22 | 0.78 | ○○○○○ 0.06 | 0.0631307490103002 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,468,507 | 0.21 | 0.98 | ○○○○○ 0.29 | 0.287156600263073 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,468,226 | 0.62 | 0.87 | ○○○○○ 0.5 | 0.501205786808156 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,468,507 | 0.67 | 0.75 | ○○○○○ 0.52 | 0.522630707180787 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,468,226 | 1.26 | 0.26 | ○○○○○ 0.83 | 0.831764814197945 | 23637626 |
Retrieved 5 of 5 entries in 1.9 ms
(Link to these results)