Bacterial taxon 909946
Locus STM474_0492
Protein WP_001278792.1
maltose O-acetyltransferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 183 aa, Gene maa, UniProt E8X858
>WP_001278792.1|Salmonella enterica Serovar Typhimurium ST4 74|maltose O-acetyltransferase
MSDEKQKMIAGALYCPTDETLCQDRLRARQLIHQYNYTTPDEINKRQAILRDLLGRCEDAYIEPSFRCDYGYNIFLGHSFYANFDCVMLDVCPIHIGDNCMLAPGVHIYTATHPLDAVERNSGRELGKPVTIGNNVWIGGRAVVNPGVTIGDNVVVASGAVVIKNVPPDVVVGGNPARIIKKL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 527,404 | 1.89 | 0.018 | ○○○○○ 1.16 | 1.15637028154953 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 527,404 | -0.83 | 0.72 | ●○○○○ -0.25 | -0.253399381158849 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 527,399 | -0.28 | 0.71 | ○○○○○ 0.03 | 0.0295170120025506 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 526,932 | -0.27 | 0.94 | ○○○○○ 0.04 | 0.0382287075788522 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 527,409 | 0.01 | 1 | ○○○○○ 0.18 | 0.181215630382222 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 527,409 | 0.01 | 1 | ○○○○○ 0.18 | 0.182935698374023 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 526,932 | 0.4 | 0.5 | ○○○○○ 0.39 | 0.386489741066393 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 527,399 | 0.71 | 0.56 | ○○○○○ 0.55 | 0.545044157668344 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 527,409 | 0.84 | 0.3 | ○○○○○ 0.61 | 0.612400566104495 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 526,932 | 1.68 | 0.13 | ○○○○○ 1.05 | 1.04725431129729 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 527,399 | 2.24 | 0.15 | ○○○○○ 1.34 | 1.34088902381336 | 23637626 |
Retrieved 11 of 11 entries in 1.9 ms
(Link to these results)