Bacterial taxon 909946
Locus STM474_1532
Protein WP_000968968.1
MarC family NAAT transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 221 aa, Gene marC, UniProt E8XIA1
>WP_000968968.1|Salmonella enterica Serovar Typhimurium ST4 74|MarC family NAAT transporter
MMDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSYMASVYVFAIMMVAYYAGQLVMNTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAHESPEAKSKSEELADEPTANIAFVPLAMPSTAGPGTIAMIISSASTVRHGGEFPDWVIMVAPPIIFLAVAVILWGCLRSSGAIMRLVGKGGIEAISRLMGFLLVCMGVQFIINGVLEIIKTYH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,555,640 | 1.13 | 0.67 | ○○○○○ 0.77 | 0.766527121026424 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,555,640 | 1.24 | 0.28 | ○○○○○ 0.82 | 0.820534483763117 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,555,640 | 1.37 | 0.062 | ○○○○○ 0.89 | 0.890366036007736 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)