Bacterial taxon 909946
Locus STM474_0983
Protein WP_001109471.1
MBL fold metallo-hydrolase
Salmonella enterica Serovar Typhimurium ST4 74
Length 215 aa, Gene ycbL, UniProt E8XDE9
>WP_001109471.1|Salmonella enterica Serovar Typhimurium ST4 74|MBL fold metallo-hydrolase
MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQDEMPVW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,044,565 | 1.32 | 0.012 | ○○○○○ 0.86 | 0.862680748613418 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,044,565 | 0.32 | 0.82 | ○○○○○ 0.34 | 0.341432480908766 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,044,565 | 0.61 | 0.89 | ○○○○○ 0.49 | 0.494971424990508 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)