Bacterial taxon 909946
Locus STM474_4792
Protein WP_000371685.1
MDR efflux pump AcrAB transcriptional activator RobA
Salmonella enterica Serovar Typhimurium ST4 74
Length 289 aa, Gene rob, UniProt E8XDC0
>WP_000371685.1|Salmonella enterica Serovar Typhimurium ST4 74|MDR efflux pump AcrAB transcriptional activator RobA
MDQAGIIRDLLIWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGAYIRARRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFSQTPALYRRSSEWSAFGIRPPLRLGEFTVPEHQFVTLEDTPLLGVTQSYSCSLEQISDFRHEMRVQFWHDFLGHSPTIPPVLYGLNETRPSMEKDDEQEVFYTTALPQEQADGYVQSAHPVLLQGGEYVMFTYEGLGTGVQDFILTVYGTCMPMLNLTRRKGQDIERYYPSEDTKTGDRPINLRCEFLIPIRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,863,967 | -2.59 | 0.02 | ●●○○○ -1.17 | -1.16684993257363 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,863,967 | -1.33 | 0.0026 | ●○○○○ -0.51 | -0.513127294386445 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,863,967 | -1.17 | 0.49 | ●○○○○ -0.43 | -0.430400573874554 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)