Bacterial taxon 909946
Locus STM474_0362
Protein WP_000737127.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 74 aa, Gene n/a, UniProt E8XJP6
>WP_000737127.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MKKLTMRECESINPTMLLAIKILISALDEKTKIRLREHIEKTEQEIASSIHDSIMTETFLQQMKDIRYILNIVP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 391,349 | -0.33 | 0.67 | ○○○○○ 0 | 0.00437772371742694 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 391,349 | -0.07 | 0.98 | ○○○○○ 0.14 | 0.141881477603638 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 391,346 | 0.81 | 0.81 | ○○○○○ 0.6 | 0.597601373510617 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 391,349 | 1.03 | 0.42 | ○○○○○ 0.71 | 0.71030526944605 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 391,346 | 2.46 | 0.24 | ○○○○○ 1.45 | 1.45370320505845 | 23637626 |
Retrieved 5 of 5 entries in 1.6 ms
(Link to these results)